PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_F6FBC974C.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 373aa    MW: 40160.7 Da    PI: 5.8321
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_F6FBC974C.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY85.84e-27189244259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            dDgynWrKYGqK vkg ++p+sYY+Ct  +Cpv+k+ve+sa d+++++i+Y+g+H he
  Traes_2DS_F6FBC974C.2 189 DDGYNWRKYGQKAVKGGKYPKSYYKCTL-NCPVRKNVEHSA-DGRIIKIIYRGQHCHE 244
                            8*************************97.7***********.***************7 PP

2WRKY345.7e-11352373122
                            ---SS-EEEEEEE--TT-SS-E CS
                   WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                            ldDgy+WrKYGqK+v+g+++pr
  Traes_2DS_F6FBC974C.2 352 LDDGYRWRKYGQKVVRGNPHPR 373
                            59*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-24185246IPR003657WRKY domain
SuperFamilySSF1182901.44E-21187246IPR003657WRKY domain
SMARTSM007741.1E-28188245IPR003657WRKY domain
PfamPF031062.2E-21189243IPR003657WRKY domain
PROSITE profilePS5081120.885189246IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-11339373IPR003657WRKY domain
SuperFamilySSF1182905.1E-9345373IPR003657WRKY domain
PROSITE profilePS5081116.134347373IPR003657WRKY domain
PfamPF031061.0E-6353373IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MAAGQWSGIG DGGGLWAPPA LYSLFPDEQP ALGFYGGSLA QLPSPPPLLG YPQDNFDVFH  60
EQDLAQLAAQ VAQKKELRGK QGAGLHHKIG PQLAFSKYSI LDQVDNSSSF SLATSVLTPQ  120
HVSSSVGAAS MQGQTLPSHT GSGSVNTGPT GVLQVLQDSS TTLDSINTGS AGVLEALQGS  180
SITLDRPADD GYNWRKYGQK AVKGGKYPKS YYKCTLNCPV RKNVEHSADG RIIKIIYRGQ  240
HCHEPPSKRF KDCGDLLNEL DDFNDAKEPS TRSQLGCQGY YGKPITPNGT MVDGLLPTKE  300
EGDEQLSSLS DIREGDCEIR IVDADVGDAD ANERNVPGQK IIVSTTSDVD LLDDGYRWRK  360
YGQKVVRGNP HPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-151892471878Probable WRKY transcription factor 4
1wj2_A5e-151892471878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654300.0EU665430.1 Triticum aestivum WRKY19 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562765.11e-163PREDICTED: probable WRKY transcription factor 3 isoform X1
TrEMBLW5C9U50.0W5C9U5_WHEAT; Uncharacterized protein
STRINGMLOC_5850.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.18e-48WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]